PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000148689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 279aa    MW: 31744.9 Da    PI: 6.2298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000148689genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +v ++G ++W++ ++  g+ R++k+c++rw +yl
    MDP0000148689 14 KGAWSPEEDNMLKAYVDKHGHKNWRALPKLAGLARCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.94.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE  l++++++++G++ W+ Ia++++ gRt++++k++w++y
    MDP0000148689  67 RGNYSQEENNLIIKLHEEFGNK-WSMIAAKLP-GRTDNDIKNHWHTY 111
                      899*******************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.785961IPR017930Myb domain
SuperFamilySSF466891.8E-3012108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-221568IPR009057Homeodomain-like
CDDcd001671.24E-111661No hitNo description
PROSITE profilePS5129424.19162116IPR017930Myb domain
SMARTSM007175.6E-1666114IPR001005SANT/Myb domain
PfamPF002494.7E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2469114IPR009057Homeodomain-like
CDDcd001674.46E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVRAPFYDKN GQKKGAWSPE EDNMLKAYVD KHGHKNWRAL PKLAGLARCG KSCRLRWTNY  60
LQPGVKRGNY SQEENNLIIK LHEEFGNKWS MIAAKLPGRT DNDIKNHWHT YFKKLTKQNS  120
TALSQTTEQS SDAPSVTSQN TELGAQSAPK HDNNGHQILE SSPLSPETFS SGXSLSSNIN  180
HGHDQPIVSY FSAEDGTLAS SETILDKSSG DFWTEPFQPD NMMNDVQSEY YPITYLREEG  240
ILSSPFLTFY DTHDGMDWFH HVMPTLQDNY LINDADYLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141147106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342092.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM5XF333e-96M5XF33_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-56myb domain protein 15